PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G20350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 277aa    MW: 29846.4 Da    PI: 4.7425
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G20350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.8e-081754148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g          + R++k+c++rw +yl
  LPERR05G20350.1 17 KGLWSPEEDEKLYNHIIRHGVG----------LQRCGKSCRLRWINYL 54
                     678*****************88..........56************97 PP

2Myb_DNA-binding52.88.9e-1760104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  LPERR05G20350.1  60 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 104
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.5311254IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-131357IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2415101IPR009057Homeodomain-like
SMARTSM007171.8E-41656IPR001005SANT/Myb domain
PfamPF002494.5E-61754IPR001005SANT/Myb domain
PROSITE profilePS5129426.03855109IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2658109IPR009057Homeodomain-like
SMARTSM007172.5E-1659107IPR001005SANT/Myb domain
PfamPF002495.4E-1560104IPR001005SANT/Myb domain
CDDcd001677.21E-1162102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRISSSGGG VQAKLRKGLW SPEEDEKLYN HIIRHGVGLQ RCGKSCRLRW INYLRPDLKR  60
GSFSQQEEDL IVALHEILGN RWSQIASHLP GRTDNEIKNF WNSCLKKKLR QRGLDPATHK  120
PLAMVASSPD EHLDDVDEDQ KPLAVAGAVV VGGGEGLAVA KKSVFDPFPV MADFGVGAGF  180
DLAAAAALFD AGAGGDYSSV LDVSENLGYG GGGGESSSNS SNWTCAEVMS NVLDWAGAGE  240
VAVAAKVEDD AVLEEKFSLP LQEQSLAYFD FNLEYNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25151095108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874696e-78AK287469.1 Oryza sativa Japonica Group cDNA, clone: J043021L20, full insert sequence.
GenBankCT8377896e-78CT837789.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN047M16, full insert sequence.
GenBankGU0467886e-78GU046788.1 Oryza sativa Japonica Group cultivar Dongjin-byeo myb-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654733.11e-122PREDICTED: myb-related protein Hv33-like
RefseqXP_015638185.11e-121PREDICTED: myb-related protein Hv33
SwissprotP200273e-98MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0D9WJA40.0A0A0D9WJA4_9ORYZ; Uncharacterized protein
STRINGORGLA05G0210500.11e-124(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-63myb domain protein 86